PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010109060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family Trihelix
Protein Properties Length: 1027aa    MW: 114283 Da    PI: 7.698
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010109060.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix29.61.8e-092483072181
        trihelix  21 lrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpy 81 
                     l +gk ++ + +ev+++++++g++r +k+   kw+n+ ++++k+ e+e++++ e++   +y
  XP_010109060.1 248 LTKGKTRADKDKEVAEFLQRHGVNRDAKTAGTKWDNMLGEFRKVYEWERGGEREQV-GKSY 307
                     56788899999**************************************9965555.3445 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.25.10.104.0E-41474IPR011989Armadillo-like helical
SuperFamilySSF561129.95E-138651012IPR011009Protein kinase-like domain
Gene3DG3DSA:1.10.510.104.3E-5868969No hitNo description
CDDcd001804.84E-108741007No hitNo description
Gene3DG3DSA:1.25.10.104.0E-49761009IPR011989Armadillo-like helical
Sequence ? help Back to Top
Protein Sequence    Length: 1027 aa     Download sequence    Send to blast
MGGDNKGETT KKPQQSKPSQ PSQQQQQQQQ QQQNPQPQQQ QQQQQQQQQQ ISISSPKDPI  60
LEESTDQTRL ISAPLFIPGG ATSSSPFDHQ QFDQAVTNPK RPRYTSATGQ WKLLPSPSSQ  120
QKVVQTQMTV LTSESSPSPT AYPPASSIVP ANISQPRALH SAAASSSDTA SSPSHSLPSG  180
QDTSKPEGEN QVHQQFRKGK YVSPVWKPNE MLWLARAWRV QYQSGGGSNG SGTSSRVAEP  240
TEHGGAALTK GKTRADKDKE VAEFLQRHGV NRDAKTAGTK WDNMLGEFRK VYEWERGGER  300
EQVGKSYFRL SPYERKLHRL PASFDEEVFE ELSQFMGSRM RTPQSRAASG ILVAAGDDSR  360
IRASLPAPAP FKEDEQFPLP ARTKQLIIGS GGETFYYGGS GSGRGGALMG FESSGDMAGP  420
SPPSSSSSKE LRRIGKVRMT WEESVSLWAE EGEHHRGRVK LQGGSLSFLN ADELTYFDDA  480
MVACTLEGFE EGPLRGFSVD RFVSGQQVKV FGRKKPFSVS AAPGFQEKVQ QQLPFTEASI  540
RSIPPWEFQD ASDYYVGCLR VPPPSIPSLF ELSWYLQEPP PEELRIPLRK DVYRDLPQGK  600
DLFFTMSTEL LDCRAITYDI LSPIIRPTPS LTSSTATSRE SFVGLWDDCI NRIVSKFCSV  660
EMVTIRKPTS TSSTEVLQDQ WPNLTGFVRN FCLWRGEETD QLREGQIDPS NSIVEKLLWT  720
YGDVPYILGY YVIGFLVTFC ALSRAQDRII RTDLQTLDLS SPSDRLKALV PCYRIAGLLP  780
LLADRCFINV NSKTLIYSDF ERVDNGNGNV TEMTPNTATR FFPNRRKWAA VKEIYDFLDH  840
RIPHAEFVHR SSEKDLSLVF KPRGIKTKPA NCDQLVEALK YVTKALVALH DLSFMHRDLS  900
WDKVMMRRAE RGDQIMGAEW FVCGFEEAVG APQIYPHSSS SAARGAHAPE MERGLHGVKV  960
DVWGMGNLVR TCGVVGGVPK MLRELQNRCL DQNPELRPTA ADCYHHLLQL QSSLQTASAA  1020
ASGGVLM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010109060.10.0hypothetical protein L484_012935
TrEMBLW9SQI90.0W9SQI9_9R
STRINGVIT_16s0022g02290.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF118572831
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33550.19e-08Trihelix family protein